SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297749|ref|NP_680996.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22297749|ref|NP_680996.1|
Domain Number - Region: 320-348
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.033
Family Rubredoxin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22297749|ref|NP_680996.1|
Sequence length 390
Comment transposase [Thermosynechococcus elongatus BP-1]
Sequence
MEKAFSYRFYPTTEQESLLRRTLGCVRLVYNRALAARTEAWYERKERLDYVQTSALLTKW
KKQDDLQFLNEVSSVPLQQALRHLQSAFTNFFAGRAKYPNFKKKRNGGSAEFTKSAFRWK
DGKVFLAKCNEPLNIRWSRRLPDGVEPSTVTIRLNPAGQWYISLRFDDPRDLTLQPVDPS
VGLDVGMSSLITLSTGEKIANPKHFNRYYKRLRKAQRSLSRKQKGSRNWDKARLKVAKIH
QKISDSRKDHLHQLTTRLIRENQTIVIESLAVKNMVKNRQLARSISDAGWGELVRQLEYK
AQWYGRTLVKIDRWFPSSKRCGQCGHIVERLPLSVREWDCPKCGAHHDRDINAAGNILAV
GHTVTVCGAGVRPDRHTSGGQLRRSRKSQK
Download sequence
Identical sequences Q8DMB6
197221.tll0205 TeR165 NP_680996.1.97157 gi|22297749|ref|NP_680996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]