SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297771|ref|NP_681018.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297771|ref|NP_681018.1|
Domain Number 1 Region: 456-869
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.06e-119
Family Iron-containing alcohol dehydrogenase 0.00000145
Further Details:      
 
Domain Number 2 Region: 11-462
Classification Level Classification E-value
Superfamily ALDH-like 6.02e-78
Family ALDH-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22297771|ref|NP_681018.1|
Sequence length 885
Comment bifunctional acetaldehyde-CoA/alcohol dehydrogenase [Thermosynechococcus elongatus BP-1]
Sequence
MNAPTLTSDPPVQSLADLEGLIERVQRAQSQYAQFTQEQVDHIFHEAAMAANQARIPLAK
QAVAETGMGVVEDKVIKNHFASEYIYNKYKNEKTCGVIEDDPIFGIQKIAEPVGIIAGVV
PVTNPTSTTIFKALIALKTRNGIIFSPHPRAKACTVAAAKVVLDAAVAAGAPPDIIGWID
EPTIELSQALMQHPQIKLILATGGPGMVKAAYSSGHPAIGVGAGNTPVLIDATADIPTAV
SSILLSKAFDNGMICASEQAVIVVDEIYDALKAEFQRRGAYLLSPEERQQVAQLLLKDGR
LNAAIVGQSAATIAAMANIQVPPETRVLIGEVSEVGPQEPFSYEKLCPVLALYRAPQFHK
GVEIAAQLVNFGGKGHTSVLYTDPRNQDDIAYFKYRMQTARVLINTPSSQGAIGDLYNFK
LDPSLTLGCGTWGGNVTSENVGPRHLLNIKTVSDRRENMLWFRVPPKIYFKPGCLPIALR
ELAGKKRAFLVTDKPLFDLGITEPIVHTLEELGIKYDIFHEVEPDPTLSTVNRGLGLLRQ
YQPDVIVAVGGGSPMDAAKVMWLLYEHPEVEFDGLAMRFMDIRKRVYQLPPLGQKAILVA
IPTTSGTGSEVTPFAVVTDDRVGIKYPLADYALTPTMAIVDPDLVLHMPKKLTAYGGIDA
LTHALEAYVSVLSTEFTEGLALEAIKLLFTYLPRAYRLGAADPEAREKVHYAATIAGMAF
ANAFLGVCHSLAHKLGSTFHVPHGLANALMISHVIRYNATDAPLKQAIFPQYKYPQAKER
YAQIADFLELGGTTPEEKVERLIAAIEDLKAQLEIPATIKEALNSEDQAFYEQVESMAEL
AFDDQCTGANPRYPLIQDLKELYILAYMGCRRDAAAYYGGEATGS
Download sequence
Identical sequences Q8DM94
gi|22297771|ref|NP_681018.1| NP_681018.1.97157 197221.tlr0227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]