SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297792|ref|NP_681039.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22297792|ref|NP_681039.1|
Domain Number - Region: 4-54
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0118
Family GSPII protein E N-terminal domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22297792|ref|NP_681039.1|
Sequence length 100
Comment hypothetical protein tll0248 [Thermosynechococcus elongatus BP-1]
Sequence
MLYSPQLFHYLEQELALPPQSIAMAVRQWQQQRASLPIILWQYGLMTLEQLDWIFEWLDQ
TRGDRLPQSSSKETLLPSCPSRNRTCEFPRIRLKPLQSLL
Download sequence
Identical sequences Q8DM75
197221.tll0248 gi|22297792|ref|NP_681039.1| NP_681039.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]