SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22297829|ref|NP_681076.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22297829|ref|NP_681076.1|
Domain Number 1 Region: 9-449
Classification Level Classification E-value
Superfamily ADC synthase 2.49e-131
Family ADC synthase 0.00000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22297829|ref|NP_681076.1|
Sequence length 458
Comment anthranilate synthase component I-like protein [Thermosynechococcus elongatus BP-1]
Sequence
MMGPCEPWLWRSLPLGGRTGRVIFQQLFLREPIAVLLESPAQAPTPQARYSICAGSPRRD
RQWVLSLGEVLPTLQTFPQGSTVPEAVSHLPFAGGWLGWLGYELAWEIEALPPPKPDPLP
FPVAFWYEPQAFAVLDHQADCLYLAASSASQLAALQQTLEEPSPEQSLLFPDRPGRIELA
AGWQPHTYQAAVEHILRHIRAGDIFQANLSARFCHDGGVDPWQQYLRLQQINPSPFASFW
QTPWGYIVSCSPERLVQVQGDWVQTRPIAGTRPRGQTPAADRAYAEELRSNIKEQAEHIM
LVDLERNDLGRICQWGTVVVDELLSLEYYSHVMHLVSNVRGKLQPGRSPVDVIRALFPGG
TITGCPKVRCMEILAGLEPFPRNLFYGSCGYWDQRGHLDLNILIRTLLVGRDRQTTWGQV
GAGIVADSAPEREWHESLSKAQALLLALGTPTPIATHS
Download sequence
Identical sequences Q8DM38
197221.tlr0285 NP_681076.1.97157 gi|22297829|ref|NP_681076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]