SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298050|ref|NP_681297.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298050|ref|NP_681297.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 1.85e-52
Family Dimethylarginine dimethylaminohydrolase DDAH 0.033
Further Details:      
 
Weak hits

Sequence:  gi|22298050|ref|NP_681297.1|
Domain Number - Region: 612-695
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00131
Family Pyruvate oxidase and decarboxylase, middle domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298050|ref|NP_681297.1|
Sequence length 699
Comment hypothetical protein tll0507 [Thermosynechococcus elongatus BP-1]
Sequence
MSSTLRFLMCPPTYYEVDYVINPWMEGNIHKSSRDRAQQQWQKLYEMIHARATVELIEPQ
PGWPDMVFTANAGLVLGDRVVLSRFYHPERQGEEPYFKGWFESQGYQVFELPKQVPFEGA
GDALLDREGRWLWAGYGFRSELDSHAYLAKWLDIEVLSLRLMDERFYHLDTCFCPLTDGY
LLYYPPAFDAYSNRLIELRVPADKRIAVKETDAVNFACNAVNIDRTVILNCASQELKSAL
AQVGFEVVETPLTEFLKAGGAAKCLTLRVTEPVREELHAPVTLPNRVVHLEGHLLDSGLM
NRVLDTIVENGGSFQVLQFNLGEQRQSPSQADIRVMAPDAEVMEAIMAQLITLGAILPPS
EVCDATLETVTQAGVAPDDFYVTTIYPTEVRVAGEWVRVQNQRMDGAIVVRSTPEGTVAE
CRILRDLQVGDRVVVGVEGIRTIRKTESQRNNQEFTFMGSGVSSERRVELVVEQIAWELR
RIRDQGGKAIVVAGPVVIHTGGGEHLAKLIREGYVQGLLGGNAIAVHDMEQAIMGTSLGV
DMKRGVPVRGGHRHHLKVINTIRRCGSIANAVAQGILTSGVMYECVKNNVPFVLAGSIRD
DGPLPDTLMDLMVAQREYARLIRGANMILMLASMLHSIGVGNMTPAGVKLVCVDINPAVV
TKLADRGSVESVGVVTDVGLFLSLMVQQLERLNRPYTLA
Download sequence
Identical sequences Q8DLI4
NP_681297.1.97157 197221.tll0507 TeR182 gi|22298050|ref|NP_681297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]