SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298066|ref|NP_681313.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298066|ref|NP_681313.1|
Domain Number 1 Region: 122-339
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.16e-55
Family ATP-binding domain of peptide synthetases 0.00011
Further Details:      
 
Domain Number 2 Region: 3-121
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.15e-33
Family D-Alanine ligase N-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298066|ref|NP_681313.1|
Sequence length 343
Comment D-alanyl-alanine synthetase A [Thermosynechococcus elongatus BP-1]
Sequence
MGRLRVGLLFGGRSREHEVSVVSAAAIAQAFAAGDNGDRYEVIPIYIEKDGRWRHTERVG
IPEGTAPESSLWQFPAVVDTIDVWFPIVHGPNGEDGTIQGLLELMQRPYVGSGVAASAIG
MDKILMKTVFGAIGLPQVPYVALQRSDLWSDPCRYNHLCDRIETELGYPCFVKPANLGSS
VGISKAKNRQQLTTALEVAAELDRRIIVEAGVVARELECAVLGNDKPQASVVGEITYSSE
FYDYETKYTDGRAQLHIPAEIPPAVSEQIRSLSLQAFQALGAAGLARFDFFYVPSTGEVL
INEVNTLPGFTALSMYPQLWAASGLSFPELVHRLVQLALEWHA
Download sequence
Identical sequences Q8DLH0
NP_681313.1.97157 197221.tll0523 gi|22298066|ref|NP_681313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]