SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298071|ref|NP_681318.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298071|ref|NP_681318.1|
Domain Number 1 Region: 166-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-72
Family Extended AAA-ATPase domain 0.0000000412
Further Details:      
 
Domain Number 2 Region: 421-614
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.35e-70
Family FtsH protease domain-like 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298071|ref|NP_681318.1|
Sequence length 619
Comment cell division protein [Thermosynechococcus elongatus BP-1]
Sequence
MAIKNSPEVPRNRWIGNALLFLGLGFLLLNLFFPQLFAPRPPQVPYSMFIHQVQEGDVAR
VYLGQNEILYQLKPQGDKPPQVLATTPIFDLELPKRLEEKGVEFAAAPPPRNSWLLNILG
WVIPPIVFVLILQFFANRQAGGGPQGVLSISKSRAKVYVEGANTGIRFDDVAGVEEAKAE
LVEIVDFLKNPQRYIQIGARIPKGVLLVGPPGTGKTLLAKAVAGEANVPFFSISGSEFVE
LFVGVGSARVRDLFEQAKKQAPCIVFIDELDAIGKSRSSAGFYGGNDEREQTLNQLLTEM
DGFDATGATVIVLAATNRPETLDPALLRPGRFDRQVLVDRPDLSGREAILKIHAKKVKLA
PEVDLHAIAARTPGFAGADLANLVNEAALLAARHQREMVTQQDFAEAIERIVAGLEKKSR
VLNDKEKKIVAYHEVGHALVGCALPGSGRVEKISIVPRGMAALGYTLQLPTEDRFLLDER
ELRAQIATLLGGRSAEEIVFGTITTGAANDLQRATDLAERMVRSYGMSKVLGPLAFEQQQ
SSFLTNTGMMLRAVSEETAQAIDREVKEIVESAHQQALSILQENRDLLEAIAQKLLEKEV
IEGEELQELLAQVKTPAAA
Download sequence
Identical sequences Q8DLG5
NP_681318.1.97157 gi|22298071|ref|NP_681318.1| 197221.tlr0528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]