SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298180|ref|NP_681427.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298180|ref|NP_681427.1|
Domain Number 1 Region: 6-171
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.00000000000000471
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298180|ref|NP_681427.1|
Sequence length 221
Comment hypothetical protein tll0638 [Thermosynechococcus elongatus BP-1]
Sequence
MAKPAPYQPLLLRLTHGAIAILVLLALLSGFWVYNTYDGRWGSLPLPQIPDIQGLHGTIA
LVLLLLFPLFALYCFHWGDRRLLHKKSLAQLSQGNWPAWQRLANTLMLVAVTFALITGRM
MKEEWLPAGDLNRGWYLAHLGAWSGVLLGLLSHLILGAKAGGRALLASMISFAIRPEDRR
LQNWWRGGRLKPSSQLLLGLEISVLLGIGAAFVLPAVIAAQ
Download sequence
Identical sequences Q8DL59
197221.tll0638 NP_681427.1.97157 gi|22298180|ref|NP_681427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]