SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298204|ref|NP_681451.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298204|ref|NP_681451.1|
Domain Number 1 Region: 227-423
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.71e-64
Family B3/B4 domain of PheRS, PheT 0.00000621
Further Details:      
 
Domain Number 2 Region: 56-214
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-48
Family Myf domain 0.0025
Further Details:      
 
Domain Number 3 Region: 514-728
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.95e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 4 Region: 739-840
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.79e-27
Family Anticodon-binding domain of PheRS 0.0004
Further Details:      
 
Domain Number 5 Region: 433-522
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000137
Family Domains B1 and B5 of PheRS-beta, PheT 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298204|ref|NP_681451.1|
Sequence length 841
Comment phenylalanyl-tRNA synthetase subunit beta [Thermosynechococcus elongatus BP-1]
Sequence
MPSQQSRLKNGKVRRYFEDSMRVSLRWLRELVAVDLDVTMLADRLTMAGFEVEDIEDRRT
WAEGVVVGYILACEPHPNAQKLRVCQVDVGQGEPRTIVCGAPNAAAGLYVPVALPGAYLA
KIDLKIRPAKLRGVKSEGMICSLAELGLTKESEGIHTFTDAVTVGEDVRPLLGLDDVILH
LTSTANRADALSMVGIAREVAALTGAPLTLPTPRAIAPKKSGAKGPVQLAIADPQACPAY
CGTLITHVQIAPSPLWLQQRLEAAGLRAINNVVDITNYILLKWGQPLHAFDWDRLQKVAA
QTPVSVGVRFAKAGETLKTLDGQERRLSSENLLITAGDVPVALAGVMGGEETEVHPGTQN
VFLEAALFASPVIRRSARAQGLRTEASARYERGVNPAELEAATAEAIALLKEIAQGTVSD
TTLADQRPPLERTLTLRLEQVHRLLGAVVSEAEDSDEPAYLDPETVEELLSRLGFHLSRQ
ETLEDELVVWSVTVPPYRFRDIEREVDLIEEIARLYGYDRFEETLPAQTEVGALPLELTL
LREVRAAFRGAGLTELMHYSWVKGGQPNQVTVVNPLVAEFSSLRTDLITGLVQAFRYNHE
QGNPPLNGFEIGRVFGQDEEGLWENDRLGGIIGGDPWQGKWVRRSQQPQPLTWYEAKGIL
ESVFQRFGLNVEYQSDRHDERLHPGRTAVLCLQGERLGIFGQLHPQYAATLEIPAAIYVF
ELDLEVLLSRLEERYRQIVFQPFSTYPASDRDLAFFAPTALTVAELSRTIWKAAGGRDSF
LESVELFDEYSGSGVPAGQRSLAFRLTYRASDRTLTEAEVNELHQRIRDSLVEKYAVTLR
S
Download sequence
Identical sequences 197221.tll0662 NP_681451.1.97157 gi|22298204|ref|NP_681451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]