SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298287|ref|NP_681534.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298287|ref|NP_681534.1|
Domain Number 1 Region: 8-277
Classification Level Classification E-value
Superfamily Folate-binding domain 1.32e-93
Family Aminomethyltransferase folate-binding domain 0.000000965
Further Details:      
 
Domain Number 2 Region: 270-359
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 3.11e-27
Family Aminomethyltransferase beta-barrel domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298287|ref|NP_681534.1|
Sequence length 366
Comment glycine cleavage system protein T [Thermosynechococcus elongatus BP-1]
Sequence
MISMAEALQRTPLYPLHQGARFTPFGDWEMPLQYSSILQEHQAVRQQVGMFDISHMGKLV
LRGEGVLGALQTLVPTNLSQLQPGQAKYTVLLNEAGGIVDDVILYMGDGQVRCIVNAATT
AKDWAWFQKYLPASIEVIDESASQVLIALQGPAATATLSPLCDRPLGEIKTYRHAPVNLL
GQPAWIARTGYTGEDGWEILVPAELGQQLWQTLLAAGVTPCGLGARDTLRLEAAMLLYGQ
DMDEQTTPLEAGLDGLIDWQKPDFVGRAALLAQKQQGIERQLVGLELLGKGIARHGYPIY
AGAQAVGEVTSGTLSPTLGKAIALGYVFPEFAHIGRELAVQVRDRWVPAVVVPRPFYRRP
RSTAKI
Download sequence
Identical sequences Q8DKV6
NP_681534.1.97157 197221.tll0745 gi|22298287|ref|NP_681534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]