SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298339|ref|NP_681586.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298339|ref|NP_681586.1|
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.75e-39
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298339|ref|NP_681586.1|
Sequence length 161
Comment cytochrome b6-f complex subunit IV [Thermosynechococcus elongatus BP-1]
Sequence
MAKVLKKPDLTNPALRAKLKKGMGHNYYGEPAWPNDLLYIFPVVIMGTIALVIGLAVMDP
AMVGEPADPFATPLEILPEWYLYPTFQIFRVVPNKLLGVLMNASIPLGLMLIPFIESVNK
FQNPFRRPVAMTVFLFGTLVTLWLGIGAAFPLDKSLTLGLF
Download sequence
Identical sequences P0C8N2 P0C8N3
gi|22298339|ref|NP_681586.1| NP_681586.1.97157 197221.tlr0797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]