SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298350|ref|NP_681597.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298350|ref|NP_681597.1|
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily Hsp33 domain 2.22e-70
Family Hsp33 domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 234-293
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.35e-17
Family HSP33 redox switch-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298350|ref|NP_681597.1|
Sequence length 299
Comment heat shock protein 33 [Thermosynechococcus elongatus BP-1]
Sequence
MADFLLRATAAAEGIRAVGVITTQLTDEARKRHQLSYVATAALGRTMAAGLILASSFKQP
QARVNVRIQGNGPLGTIFADAGADGTVRGYVQYPSVELPPNAKGKLDVGAAVGHQGYLYV
IHDLGYGYPYSSTVELVSGEIAEDITYYLATSEQTPSALMLGVFVEESGVTAAGGLMLQV
LPKAANDEHLIATLEQRVANLKGFTPLLQAGRTLPDIFQELLGDMDLQILPQRQMVRFHC
GCSHERMLAALKLLGEAELRDILATEAKAEATCQFCNAVYWADQPMLEQLIAELATASV
Download sequence
Identical sequences Q8DKQ1
197221.tll0808 NP_681597.1.97157 gi|22298350|ref|NP_681597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]