SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298360|ref|NP_681607.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298360|ref|NP_681607.1|
Domain Number 1 Region: 12-357
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.92e-86
Family Deoxyhypusine synthase, DHS 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298360|ref|NP_681607.1|
Sequence length 401
Comment deoxyhypusine synthase-like protein [Thermosynechococcus elongatus BP-1]
Sequence
MAVPAVEFPWEEQPMSAFATPITPAPIPDNISLTELIDKYFTAYNSARLREICQLLSQRV
FKPEVTVGLSLSGAMTPTGLGISALAPLVRAGFVDYIISTGANLYHDIHYALGMDLYAAH
PFVDDVQLRKESKIRIYDIIFDYDVLLETDAFLRQVLRSETFQRRMGTAEFHYHLGHYVR
ELEVQRGQPHSCLLATAYECGVPIYTSSPGDSSIGMNVAAIALEGSKLIIDPAIDVNETA
AIAYFAREAAGGKGKSAALIIGGGSPKNFLLQTQPQIHEVLGLEERGHDYFIQITDARPD
TGGLSGAVPSEAVSWGKVDPQGLRDTVVCYTDSTIALPILTAYCLNRCQPRPLKRLYDRR
GEMVERLQQLYLQAQLQHKVKELPTEAPVATYPCGTPIRRP
Download sequence
Identical sequences Q8DKP1
NP_681607.1.97157 gi|22298360|ref|NP_681607.1| 197221.tlr0818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]