SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298364|ref|NP_681611.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298364|ref|NP_681611.1|
Domain Number 1 Region: 34-119
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.45e-24
Family Pentapeptide repeats 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298364|ref|NP_681611.1|
Sequence length 153
Comment hypothetical protein tlr0822 [Thermosynechococcus elongatus BP-1]
Sequence
MMAKVAPALLLLLISTSAWAANPAHLEQLRRTGNCPNCDLSYARLRGRNLQGADLRGANL
NAANLRGANLSGANLSGAVLNHADLTKANLTNANLTGASLLITRLDQALLGGATLVDAIL
GGRDRLARVQTFRDATLPNGEKAFFLEESSHRP
Download sequence
Identical sequences Q8DKN7
NP_681611.1.97157 197221.tlr0822 gi|22298364|ref|NP_681611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]