SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298368|ref|NP_681615.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298368|ref|NP_681615.1|
Domain Number 1 Region: 113-461
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.1e-94
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000585
Further Details:      
 
Domain Number 2 Region: 462-584
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.35e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00056
Further Details:      
 
Domain Number 3 Region: 4-98
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 2.09e-22
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298368|ref|NP_681615.1|
Sequence length 584
Comment arginyl-tRNA synthetase [Thermosynechococcus elongatus BP-1]
Sequence
MVAPIKILGDRLRRALQAALPLDTYPQPLLVPASQVKFGDYQSNVCLSLAKQLGKAPREL
AQEVVPHLEVEDLCQPVEIAGPGFLNFRLKPEFLAATLQAARGSDRLGIPPAREPRRVVV
DFSSPNIAKEMHVGHLRSTIIGDCIARILEFQGHTVLRLNHVGDWGTQFGMLIAYLDEVY
PDALTTANALDLGDLVTFYKKAKQRFDSDPEFQQKARAKVVALQQGEEQSRRAWQLLCEQ
SRREFQKIYDLLDIQLTERGESFYNPFLPAVIEDLAACGLLVEDQGAKVVFLEGFTNKEG
QPQPLIIQKSDGGYNYATTDLAALRYRIDKDQADWIIYVTDVGQSTHFAQVFQVAQRAGW
VPPHVTLTHVPFGLVLGEDGKRLKTRSGETIRLIDLLTEAIARSRADLEQRLATEGRTES
PEFIDTVARAIGIGAVKYADLSQNRNSNYVFSYDKMLSLQGNTAPYLLYAYVRVQGLTRR
GDIDWCTLSPDSPLLLEDETEQHLAKHLVQLEETLDLVSTELLPNRLCQYLFELSQLFNQ
FYDRCPILSAPQPTKQSRLTLAYLTAQTLKLGLSLLGIPVLDRI
Download sequence
Identical sequences Q8DKN4
NP_681615.1.97157 197221.tll0826 gi|22298368|ref|NP_681615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]