SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298581|ref|NP_681828.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298581|ref|NP_681828.1|
Domain Number 1 Region: 16-222
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.93e-67
Family "Hypothetical" protein ybl036c 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298581|ref|NP_681828.1|
Sequence length 233
Comment hypothetical protein tll1037 [Thermosynechococcus elongatus BP-1]
Sequence
MLSAAEIRDRASHLKSTLPPHVRLIAVSKFMPAAAIRAAYEAGIRDFGESRVQEAASKRA
ELADLTDITWHLIGHLQTNKVRQALQLFDWIHTVDRWKLAERIDTLLKERGAASPRCLLQ
VKLRPDPQKYGWEKSDLEAALPQLDALLHLRCWGLMTILPLGLAPSEQLQVFQELRAWGE
ELSTKGWQQLRWQEYSMGMTQDYPLAVQAGATMVRIGTAIFGDRPSALKIQQQ
Download sequence
Identical sequences Q8DK33
197221.tll1037 gi|22298581|ref|NP_681828.1| NP_681828.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]