SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298670|ref|NP_681917.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22298670|ref|NP_681917.1|
Domain Number - Region: 325-353
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.033
Family Rubredoxin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22298670|ref|NP_681917.1|
Sequence length 395
Comment transposase [Thermosynechococcus elongatus BP-1]
Sequence
MPPRYPTKAFSYRFYPTTEQESLLRRTLGCVRLVYNRALAARTEAWYERKERLDYVQTSA
LLTQWKKQDDLQFLNEVSCVPLQQALRHLQSAFTNFFAGRAKYPNFKKKRNGGSAEFTKS
AFRWKDGKVFLAKCNEPLNIPWSRRLPDGVEPSTVTIRLNPAGQWYINLRFDDPRELTLQ
PVDPSVGLDVGISSLITLSTGEKIANPKHFNRYYKRLRKAQRSLSRKQKGSRNWDKARLK
VAKIHQKISDSRKDHLHQLTTRLIRENQTIIIESLAVKNMVKNRQLARSISDAGWGELVR
QLEYKAQWYGRTLVKIDRWFPSSKRCGQCGHIVERLPLSVREWDCPKCGAHHDRDINAAG
NILAVGHTVTVCGAGVRPDRHTSGGQLRRSRKSQK
Download sequence
Identical sequences Q8DJU5
197221.tlr1127 gi|22298670|ref|NP_681917.1| TeR195 NP_681917.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]