SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298696|ref|NP_681943.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298696|ref|NP_681943.1|
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily CheY-like 3.56e-41
Family CheY-related 0.00055
Further Details:      
 
Domain Number 2 Region: 177-388
Classification Level Classification E-value
Superfamily PP2C-like 0.0000575
Family PP2C-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298696|ref|NP_681943.1|
Sequence length 391
Comment two-component response regulator [Thermosynechococcus elongatus BP-1]
Sequence
MSGDRQPYQILVIDDDPTTRLLLRKTLRDLGYSVSVASHGREGIAIATAEKPALIICDWM
MPELDGLEVCRHIKQDEELSRSFFILLTAKGELQDRIQGLDAGADEFLSKPIDPNELRAR
IQAGLRLYQLSQDLLKQKQLLEAELHEAADYVRSLLPAPQEDPCKINYSFLPSSQLGGDC
FDFFWVGDRYLVLYILDVSGHGLGAALPSVSVLNLLRSTTREQTSGTFDYRHPAQVLEAL
NNGFQMTAQHEKYFTIWYGVYDRQTRQLTYASGGHPPALLLAPKAAQWQATLLKTPGIPI
GMFAEMVFTQATIEVPPSAVLYLFSDGVYEFETTDHQIWGLDAFRDLLITAHTQNPVPPL
SQLISQVQRHAAPAGFGSDDVSLVQVAFPRP
Download sequence
Identical sequences Q8DJR9
NP_681943.1.97157 gi|22298696|ref|NP_681943.1| 197221.tlr1153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]