SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298869|ref|NP_682116.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298869|ref|NP_682116.1|
Domain Number 1 Region: 20-309
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-58
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 404-501
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.44e-29
Family Pentapeptide repeats 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298869|ref|NP_682116.1|
Sequence length 524
Comment serine/threonine protein kinase [Thermosynechococcus elongatus BP-1]
Sequence
MSYCLNPNCPKPDNPDGLDICQACGSKLLLNDQYRAIKVLGRGGFGTTFLAVDTKLPGNP
TCVIKQLRPAATAPHILTMARELFLREATTLGKVGNHPQLPRLLGYLENENEFYLIQEYV
GGLTLQQEVKRFGPKSEEEVKQVLQEVLPILDYLHKNGVIHRDIKPANLIRRDIDKKLVL
IDFGAVKDKVTQAMVENAPELSTFTSFAVGTPMYAPPEQMAMRPIYASDIYALGVTCVYL
LTGKSPKEIERDPRTGEWHWQRHVKNISPQFAALLNKMLQDAVKDRYQTAMDVLADLQLL
ESNQGAAVAVPTTSTEDDDLSSALSTPPSQGRPRVPGAPKRSSYASSVSQNAQAARVRQS
RMTGTQLGGPPVVGTGPGQHLRPKVTPRMTAAQLLTAYKRGERDFIDVDLSNVVLRNADL
SGANFANANFTNADLKGCILANAVLREANFQGANLHDANLCGAYLVQANFERANLKGAKL
HDASISGANFTSADISGADFSMVSGFVQGQLDRAKKNWFTKLPK
Download sequence
Identical sequences Q8DJA1
gi|22298869|ref|NP_682116.1| NP_682116.1.97157 197221.tlr1326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]