SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298892|ref|NP_682139.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298892|ref|NP_682139.1|
Domain Number 1 Region: 125-301
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.36e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000332
Further Details:      
 
Domain Number 2 Region: 382-493
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000248
Further Details:      
 
Domain Number 3 Region: 3-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.03e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.00021
Further Details:      
 
Domain Number 4 Region: 295-367
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22298892|ref|NP_682139.1|
Sequence length 519
Comment ferredoxin-nitrite reductase [Thermosynechococcus elongatus BP-1]
Sequence
MSNKIEAIKKEKDGLAVKQELEKFAAMGWENIPEADRDVRLKWLGIFFRPVTPGRFMMRL
RVPNGILTSQQLRTLGAIVDRYGENGNGDITTRQNIQIRGLPIEDIPEIIEQLQACGITS
VQSGMDNVRNLTGSPVAGIDAAELIDTRPLIMKLQAMITNNGQGNPEFSNLPRKFNIAIE
GGRDNSVHAEINDVAFVPAYRQGRLGFNVLVGGFFSARRCAAAIPLDAWVPPDDAVVQLS
RAILEIFRDHGPRGNRQKARLRWLIDEWGIEKFRAAVVAKLPFELLSAAAKDEIDWDKRD
HLGVHRQKQRRLNYVGLHVPVGRLYATDFYELARLAQVYGQSEVRLTVEQNVIIPHVPDA
VLPSLLREPLLSKFRPEPPPLERALVSCTGAEFCNFALIETKNRALALARWLDQQLVLPQ
PVRIHWTGCPNSCGQPQVADIGLMGTKTRRNGETVDAVDLYMGGKVGKDAKLGTCVKKAI
PCDELPEVLRQVLIEQFGAQPRGSERPPVATPAVAMMVS
Download sequence
Identical sequences Q8DJ79
NP_682139.1.97157 gi|22298892|ref|NP_682139.1| 197221.tlr1349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]