SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22298893|ref|NP_682140.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22298893|ref|NP_682140.1|
Domain Number 1 Region: 51-299
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.86e-26
Family Phosphate binding protein-like 0.041
Further Details:      
 
Domain Number 2 Region: 297-358
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000824
Family Chitinase insertion domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22298893|ref|NP_682140.1|
Sequence length 439
Comment nitrate/nitrite transport system substrate-binding protein [Thermosynechococcus elongatus BP-1]
Sequence
MANFSRRRFLMTAAATTAVTLISHGCGNSQQSTDVVQPTTVAETPEVTGAKLGFIALTDA
APLIIAKEKGLFAKYGMPDVEVLKQASWGTTRDNLVLGSANGGIDGAHILTPMPYLMTVG
KITGGKPVPMYILARLNTNGQGILLANAYKDLNISTDSRPLKEAFAKTRAERRARNQNEE
IKVAVTFPGGTHDLWMRYWLAAGGIDPEKDVSMIVVPPPQMVANLKTGTMEAFCVGEPWP
LQTVNQKVGYGAITTGELWQDHPEKSFALRADWVDQHPKATKALLMAVIEAQQWCDQDAN
KPEMAKILSKREWFKVPVEDILDRSLGKFDFGNGRILEDKNLMQKYWRDNASYPYQSHDL
WFLTEDMRWGYLPPDTDAKALIQKVNREDIWREAAKTIGVSAAEIPTTTSRGVETFFDGV
AFDPQNPQAYLNSLNLRKV
Download sequence
Identical sequences Q8DJ78
197221.tlr1350 NP_682140.1.97157 gi|22298893|ref|NP_682140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]