SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299048|ref|NP_682295.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299048|ref|NP_682295.1|
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily RbcX-like 3.66e-42
Family RbcX-like 0.00000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299048|ref|NP_682295.1|
Sequence length 126
Comment hypothetical protein tll1505 [Thermosynechococcus elongatus BP-1]
Sequence
MDVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEAL
FREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRCQQLERMTQVSEANVENS
NLETPE
Download sequence
Identical sequences A3KFC8 Q8DIS6
NP_682295.1.97157 gi|22299048|ref|NP_682295.1| 197221.tll1505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]