SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299063|ref|NP_682310.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299063|ref|NP_682310.1|
Domain Number 1 Region: 29-214
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.39e-40
Family Phosphoglucomutase, first 3 domains 0.0014
Further Details:      
 
Domain Number 2 Region: 278-410
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 8.24e-29
Family Phosphoglucomutase, first 3 domains 0.0011
Further Details:      
 
Domain Number 3 Region: 411-501
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 6.41e-21
Family Phosphoglucomutase, C-terminal domain 0.0044
Further Details:      
 
Domain Number 4 Region: 185-290
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.45e-20
Family Phosphoglucomutase, first 3 domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299063|ref|NP_682310.1|
Sequence length 504
Comment phospho-sugar mutase [Thermosynechococcus elongatus BP-1]
Sequence
MICSEEFWVLGSMVGSVLRLDQVLIPEDAPIRFGTDGWRGIIGAEFTFNRLLRAAKAAAA
VLYQTYGDGRTPRIIVGYDRRFLAEHFATAVAQFLTSQGYEVWLSNCAAPTPAFSWAVKA
EGAIGGLVITASHNPGIYAGLKVKGAFGGSVPTPVTEAIEAQLAQGEPPPVGEAKTDYQT
FDPWPSYCAALRTHVDPSPIREAIATGKLHVCADVMHGVAAGGLERLLDWPIEEFRRDRD
PLFGSGAPEPIGRYLAATQERLRQQHSATPTVCLVFDGDADRLAVIDGEGVLYTAQEMIP
ILIDHLAQHSPYRGAVIKSISSSDLVARVAAHHGLAVIETPIGFKYIGDRMLAGEAVLLG
GEESGGIGYGHHLPERDALLSALYLLQALVTSGLSVGEYYQQLQLTTNFYSAYDRVDLTL
TSLAQRQKLEALLGEHPFTQILDSPVSHWDTIDGYKFHLADGGWLLIRFSGTEPLLRLYC
QGKTPEQVQHILQWASQWAVAVTG
Download sequence
Identical sequences Q8DIR1
gi|22299063|ref|NP_682310.1| NP_682310.1.97157 197221.tlr1520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]