SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299215|ref|NP_682462.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299215|ref|NP_682462.1|
Domain Number 1 Region: 16-499
Classification Level Classification E-value
Superfamily ADC synthase 2.35e-156
Family ADC synthase 0.000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299215|ref|NP_682462.1|
Sequence length 506
Comment anthranilate synthase component I [Thermosynechococcus elongatus BP-1]
Sequence
MYPDFQTFCQLAEQGNFIPLYEEWVADMDTPVSAWYRVCRDRPYNFLLESVEGGEQLARY
SLLSCDPLWVLETRGNQTTQTHRDGSVTRFTGNPFTILANCLAPYQPVKLAQLPGGIGGL
FGFWGYELIQWIEPRVPIHPATARDLPDGVWMQVDQILIFDQVKRKIWAVVYADTRETDL
KTAYTHASDRLERLLRKLQTRIPPEATQLHWQPSRQIPSYTSNITSEAFRTNVARAKDYI
RAGDIFQVVLSQRLSATYRGDPFALYRSLRLINPSPYMAYFQFGTWQIIGSSPEVMVKAE
HHPENAGSLLATVRPIAGTRQRGHTYTEDQQLAAELLADTKEVAEHVMLVDLGRNDLGRV
CRQGSVSVEAFMVIERYSHVMHIVSNVVGELLPDKTAWDLLQACFPAGTVSGAPKIRAME
IIYELEGCRRGPYSGAYGYYDFEGQLNTAIAIRTMVVQPLTDHQHLIHVQAGAGIVADSD
PQREYEETLNKARGLLEAISALTTKP
Download sequence
Identical sequences Q8DIB8
gi|22299215|ref|NP_682462.1| NP_682462.1.97157 197221.tll1672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]