SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299229|ref|NP_682476.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299229|ref|NP_682476.1|
Domain Number 1 Region: 91-196
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.32e-31
Family Riboflavin synthase 0.00022
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.11e-21
Family Riboflavin synthase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299229|ref|NP_682476.1|
Sequence length 218
Comment riboflavin synthase subunit alpha [Thermosynechococcus elongatus BP-1]
Sequence
MFTGIIQAIGVLQQCSESQLVITATDAPFLGDVAVGDSIAVDGVCLTVETFDARGFTVSV
SPETLQRTTLAAKAAVGAMVNLEPALRLGDRVGGHFVTGHVDGVGTVLAIAPTGISWTFT
FSAPEAVAAYIIPKGSIAINGISLTIADCNEKGDEFSIAVIPHTYAETTLQFLRVGDGVN
LEADLLGKYTRKFLQPQNAAAAVDKEIDLGFLQAHGYA
Download sequence
Identical sequences Q8DIA4
197221.tlr1686 gi|22299229|ref|NP_682476.1| NP_682476.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]