SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299291|ref|NP_682538.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299291|ref|NP_682538.1|
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.44e-59
Family Ribosomal protein S7 0.00000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299291|ref|NP_682538.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Thermosynechococcus elongatus BP-1]
Sequence
MSRRTRAQKRPTAPDPVYNNVLVNMLIQRVMRNGKKSLASRIVYEAMKTVQERTGEDALQ
IFERAVKNATPLVEVKARRVGGATYQVPMEVRPDRGISLALRWLVQFSRKRAGRSMSAKL
ANELMDAANETGSTIRKREETHKMAEANKAFAHYRY
Download sequence
Identical sequences Q8DI44
NP_682538.1.97157 gi|22299291|ref|NP_682538.1| 197221.tlr1748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]