SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299304|ref|NP_682551.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299304|ref|NP_682551.1|
Domain Number 1 Region: 40-308
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.44e-75
Family Alanine racemase-like, N-terminal domain 0.00000995
Further Details:      
 
Domain Number 2 Region: 285-442
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.42e-50
Family Eukaryotic ODC-like 0.0000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299304|ref|NP_682551.1|
Sequence length 450
Comment diaminopimelate decarboxylase [Thermosynechococcus elongatus BP-1]
Sequence
MISTSLAANQQILPLTAQTNARGHLTIGGCDVVELVAQFGSPLYILDEFTFRTACRQYQE
TLQRAYGGESLVLYASKAWNCLATCALAHSEGLGIDVASGGELYTALSAGVPASHIYFHG
NNKSPQELLYALEVNCTIVADNWLELERLAAYVEEHDLSTPPRVMLRLTPGIECHTHEYI
RTGHLDSKFGFDPQQFPELLQFAKAHPELDWVGLHAHIGSQIFEEQPHLDLCDVLVDWLA
QARAAMLPMRELNVGGGLGIRYVESDNPPAIAHWIKAISHQLSQACQQRHLPLPKLICEP
GRSIVGPAAVTAYTVGSRKVIPELRTYIAVDGGMSDNPRPMTYQAQYTALCANRMTTAAT
ETVRVAGKHCESGDILLAHATLPPLQANDILVVASTGAYNYSMASNYNRVPRPAAVIVCD
GEANLILQRETYADLVAHDVLPLRLSTPTP
Download sequence
Identical sequences Q8DI31
NP_682551.1.97157 197221.tlr1761 gi|22299304|ref|NP_682551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]