SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299315|ref|NP_682562.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299315|ref|NP_682562.1|
Domain Number 1 Region: 12-193
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2e-45
Family Phosphoglucomutase, first 3 domains 0.00069
Further Details:      
 
Domain Number 2 Region: 271-378
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.28e-28
Family Phosphoglucomutase, first 3 domains 0.0038
Further Details:      
 
Domain Number 3 Region: 181-270
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.75e-23
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 4 Region: 375-463
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 4.71e-21
Family Phosphoglucomutase, C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299315|ref|NP_682562.1|
Sequence length 465
Comment phosphoglucosamine mutase [Thermosynechococcus elongatus BP-1]
Sequence
MLVWREESTMTGQQPIRFGTDGIRGRAGELLTPNLALSLGYWVGEVLRQTTDAPQRPFII
GQDSRNSSDMLATALAAGLTAAGFEVWHVGLCPTPCIAYLTATTEAIGGAMISASHNPPA
DNGIKIFGSDGSKLCPDLQKEIEAHLNAGRSLPYREDWGHLHHRPELVQRYRHAVQAPLQ
DRQPLRGLRVVLDLAWGSAVAVTPTVFHALGAEVIALHDRADGNRINVNCGSTYLEPLQQ
AVREARAAMGFAFDGDADRVLAVDSQGRVVDGDHILYFWGQQLQSQAQLPKDLIVATVMS
NLGFERAWQARGGQLVRAAVGDQYVHAEMLRHGAMLGGEQSGHILCRHYGVGGDGLLTAV
HLATLVQDSGLSLAQLRDQSFTPYPQILRNVRVEDRQRRLRWQECEPLQRMIAKAQLDMG
DRGRVLVRASGTEPVIRVMVEAEQQNIADYWTETLVQTVSAHLAA
Download sequence
Identical sequences Q8DI20
gi|22299315|ref|NP_682562.1| 197221.tll1772 NP_682562.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]