SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299340|ref|NP_682587.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299340|ref|NP_682587.1|
Domain Number 1 Region: 5-191
Classification Level Classification E-value
Superfamily ITPase-like 2.56e-61
Family ITPase (Ham1) 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299340|ref|NP_682587.1|
Sequence length 194
Comment deoxyribonucleotide triphosphate pyrophosphatase [Thermosynechococcus elongatus BP-1]
Sequence
MPILAQAVLASHNAGKVKEFQGWLQPWIGELVALPAAIEIAETADSFVANACLKAATAAK
VMGEWAIADDSGLAVHALQGAPGIYSARYGATDAERIERLLREMADVSDRAAEFICVIAL
ARPDGTIAVTTEGRCAGEILTAPRGQGGFGYDPVFWVPSQQRTFAEMSPVEKQQVSHRGQ
ALQRLREYFQTLNP
Download sequence
Identical sequences Q8DHZ6
197221.tll1797 NP_682587.1.97157 gi|22299340|ref|NP_682587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]