SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299369|ref|NP_682616.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299369|ref|NP_682616.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.34e-39
Family Ribosomal protein S14 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299369|ref|NP_682616.1|
Sequence length 100
Comment 30S ribosomal protein S14 [Thermosynechococcus elongatus BP-1]
Sequence
MAKKSMIEREKKRQRLVAKYASKRQELKAQLASAETQEEIMSIHRQLQRLPRNSAPSRLR
NRCWLTGRPRGYYRDFGLCRNALREMAHQGLLPGVVKSSW
Download sequence
Identical sequences Q8DHW7
gi|22299369|ref|NP_682616.1| 197221.tll1826 NP_682616.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]