SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299375|ref|NP_682622.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299375|ref|NP_682622.1|
Domain Number 1 Region: 167-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-73
Family Extended AAA-ATPase domain 0.0000000359
Further Details:      
 
Domain Number 2 Region: 422-625
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.45e-63
Family FtsH protease domain-like 0.0000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299375|ref|NP_682622.1|
Sequence length 644
Comment cell division protein [Thermosynechococcus elongatus BP-1]
Sequence
MSMKYAQRLCQRLSQLALVVGFSLAPTNIGLAQSSNNNTVSYTQFLNALKAGEVRSVELY
QEQGLAKFRRKNQPEQSPPQEVRLFDRNPELVELLRQVSSRYDTTVRVVASGNESAVVGL
VSNLMLGFLLLIVFLMILQRVSNAPGGPGQILNFGKSRARFQMEAQTGVTFGDVAGIEEA
KEELQEVVTFLKNSEKFTSIGARIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSE
FVEMFVGVGASRVRDLFRKAKENAPCLVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLT
EMDGFEGNTGIIVIAATNRPDVLDAALLRPGRFDRQITVDLPSYKGRLQILQVHARNKKI
APEVSLEAIARRTPGFSGAELANLLNEAAILTARRRKPAITNAEIDDAIDRVTIGMTLTP
LLDSKKKWLIAYHEVGHALLMTLLKHADPLNKVTIIPRSGGVGGFAQQIFDEERVDSGLY
TRAWLLDEITILLGGRAAEVEIFGDAEVTVGASSDLRAVANLAREMVTRYGMSDLGHLAL
ETTGNEVFLGRDLMPRAEYSEAVAVQIDHQVREIVMHCYEIARKLIREHRVAIDKLVELL
LEKETIDGDEFRALVRQYTTLPVKDPPWKATATPVSFRQDAERS
Download sequence
Identical sequences Q8DHW1
NP_682622.1.97157 gi|22299375|ref|NP_682622.1| 197221.tll1832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]