SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299382|ref|NP_682629.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299382|ref|NP_682629.1|
Domain Number 1 Region: 149-364
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.38e-60
Family BC ATP-binding domain-like 0.00000451
Further Details:      
 
Domain Number 2 Region: 46-147
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.61e-35
Family BC N-terminal domain-like 0.0000736
Further Details:      
 
Domain Number 3 Region: 374-468
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.04e-32
Family BC C-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299382|ref|NP_682629.1|
Sequence length 479
Comment phosphoribosylamine--glycine ligase [Thermosynechococcus elongatus BP-1]
Sequence
MSLAGRSPPIISCCLGGERCRLTDKLGKLLKIDLKNDCLSFGSGSVKVVVVGSGGREHAI
AWKLLDSPRVTQVYCLPGNGGTACLERCENVAIEATDLTGIGEFAKENNADLVVVGPEVP
LAAGLGDRLQALKIPVFGPSQAGAQIEASKAWAKALMEAAGIPTAKAAVFDNYGAASRYV
QAKGAPIVIKADGLAAGKGVTVAATEAAAIAALERIFGGEFGVAGQQVVVESVLEGQEVS
VLAVTDGKTILPLLPAQDHKRIGEGDTGPNTGGMGVYAPVPWVTPELMQRIQRTILEPAL
GALQDRGIHYCGVLYAGLMVTPAGDPYVVEFNCRFGDPETQVVLPLLETPLIDVILACVE
GRLASLGALQWRNEVALCVVMAAGGYPGSYRKGDVIQGIPEAIAQGVLVFHAGTRWQEGQ
WYTNGGRVLNITALAPDFATAQAKAYGAVNAIAFADCYYRRDIGYRILESSAHRGEYRP
Download sequence
Identical sequences Q8DHV4
NP_682629.1.97157 gi|22299382|ref|NP_682629.1| 197221.tlr1839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]