SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299417|ref|NP_682664.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299417|ref|NP_682664.1|
Domain Number 1 Region: 20-224
Classification Level Classification E-value
Superfamily Formyltransferase 1.7e-64
Family Formyltransferase 0.00000166
Further Details:      
 
Domain Number 2 Region: 223-343
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.4e-23
Family Post formyltransferase domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299417|ref|NP_682664.1|
Sequence length 350
Comment methionyl-tRNA formyltransferase [Thermosynechococcus elongatus BP-1]
Sequence
MTLLRRCKPRVDVSQGGQRLNIVYFGTPEFALAPLQRLLQTETYQVLGVVTQPDRRRGRG
NQLSPSPVKAFALRHGLPIWQPPRLRQDPQLPEVLRSLAADVFVVVAYGQILPQSILDIP
RYGCINIHGSLLPRYRGAAPIQWALYHGEEETGVTTMLMDAGLDTGPMLLKRKVRIHLED
NATTLSAKLSETGADLLLDTLQQLPQLQAEPQNDAEATYAPLIQKSDYAIDWGRSALALH
NQVRAFYPYAYTQWQGTALKILQTWPLIPEVAAKLPEPLQSYVREPEAAAPPGTVLALIK
GWGPVVQTGKGPLLLSQVQLSGRKAQSGWDFVNGVRLAIATQFAIVPSAL
Download sequence
Identical sequences 197221.tlr1874 gi|22299417|ref|NP_682664.1| NP_682664.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]