SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299449|ref|NP_682696.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22299449|ref|NP_682696.1|
Domain Number - Region: 74-185
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0769
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299449|ref|NP_682696.1|
Sequence length 190
Comment hypothetical protein tll1906 [Thermosynechococcus elongatus BP-1]
Sequence
MNHRETFKMNVRRLHRQLAIALFLPLGLTNCTGLAYRLGRSWLNLSKDFGKAMMAIHTGA
FLGEWFSVLYMFLLSLTVVLLVASGFRLINPWLLKRRFSSVKANVKVRLIHQYGALLLFL
PLLVSATTGVSYHLSRYWLRLPKEKVAILLQIHEGAYLGAALKPFYILLLSAALLLMFLS
GWRMLRQRSA
Download sequence
Identical sequences Q8DHN9
NP_682696.1.97157 197221.tll1906 gi|22299449|ref|NP_682696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]