SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299458|ref|NP_682705.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299458|ref|NP_682705.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0000014
Family Ribosomal protein L32p 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299458|ref|NP_682705.1|
Sequence length 60
Comment 50S ribosomal protein L32 [Thermosynechococcus elongatus BP-1]
Sequence
MACPKKKTSKSKRSMRRAAWKRQAALQAQRALSIGKSILTERAQGFYFPEAEEENEDEQE
Download sequence
Identical sequences Q8DHN1
197221.tsr1915 gi|22299458|ref|NP_682705.1| NP_682705.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]