SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299511|ref|NP_682758.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299511|ref|NP_682758.1|
Domain Number 1 Region: 94-257
Classification Level Classification E-value
Superfamily alpha/beta knot 3.53e-44
Family SpoU-like RNA 2'-O ribose methyltransferase 0.00023
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily L30e-like 5.06e-23
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299511|ref|NP_682758.1|
Sequence length 259
Comment tRNA/rRNA methyltransferase [Thermosynechococcus elongatus BP-1]
Sequence
MIITSRQNQLVRSIRKLHHRKYRQGHLLLEGTHLIQEALASGYHLSVVCYTSAWQAKQSP
TFWQRLLHRSDRAVEVSEEVLAALCTTTTPDGVVAVADYTPLPTLPLQSLGLCLVTLQDP
GNLGTIIRTAAAVGVEGLLLSADCVDMTHPKVLRASAGQWFRLPMQTVTDGLATLKTYQA
QGWQIVVTRPTAPLIYWQADFCQPTLLVMGNEGQGLPPAYQDASFTALRIPQEPNVESLN
VAIATAVLLYEVYRQRWRD
Download sequence
Identical sequences Q8DHJ1
NP_682758.1.97157 197221.tll1968 gi|22299511|ref|NP_682758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]