SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299538|ref|NP_682785.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299538|ref|NP_682785.1|
Domain Number 1 Region: 212-454
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-70
Family Leukotriene A4 hydrolase catalytic domain 0.00082
Further Details:      
 
Domain Number 2 Region: 17-205
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 5.1e-44
Family Leukotriene A4 hydrolase N-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 542-832
Classification Level Classification E-value
Superfamily ARM repeat 7.12e-25
Family PBS lyase HEAT-like repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299538|ref|NP_682785.1|
Sequence length 863
Comment aminopeptidase [Thermosynechococcus elongatus BP-1]
Sequence
MPSDVTPAKSFVLRGARPHYSPDRPGQVEHIFLDLTLDLEAQTCWGQCHIHLRPLHSQLR
HLRLNAVGQQIKGVTVQHQAQPFHYDGEFLEISLDESLGISPEQVLLIAIDYRLDKPQRG
LYFVSTHPPQAWTQGEDEDSRYWFPCFDYPGQLATSEIRARVRQPLQAISNGELRACYSE
GEWQVFHWHQPQVHPTYLMTLAVGDFAVFDDQWQGKPVTYYVAKDRAADALRTLGKTPKM
IDFFSRIYGYPYPYPKYAQVCVADFIFGGMENTSTTLLTDRCLLDERAATEDFRSESLVA
HELAHQWFGDLVVIKHWSHAWIKEGMASYAEVLWFEEEYGADFAAYYRLGELRSYLSEDS
DRYRRPIVTHVYRDAIELYDRHLYEKGACVYHMIRQELGEELFWKAIQTFVQTYAHQTVE
TVDLLRAIESATGRNLLPLFDQYVFRGGHPDFHVSYRWEATEQLAVITVKQQQVTEGVTP
LERNLFDLRIPIGIGTVDEQGQVSVKIMPLRIHEPEHTFYLPLPKQPRFVSFDAGNHTLK
TVTLEYPLPELKAQLQYDPDVLGRIQAAIALGKKGNLEVVQTLAEAFKGEPFWGVRREIA
KVLGTIQLDQSLDALKLALADHHPHVRAAAVEAIAGFKSAKAYELLKPIAKHGDPSYSVE
AAALKGIGVIAAAKPQPKPKPEKVLKRLRKALETRQGWNEVVRCGAIAGVGQLKDLPEAV
NLVLDYTAMDVPQPLRLAAIRTLGTIGDRHHPQLSQILERLEQLSHETFFFTQMAVVQAL
SQIDHPRVLGLLQQVGDRTTDGRIKRFVDESIAKVQKAIGSDDRLKTLETTLSELQKENQ
TLKSRLEELAARTQATNQESAPS
Download sequence
Identical sequences Q8DHG4
gi|22299538|ref|NP_682785.1| 197221.tlr1995 NP_682785.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]