SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299574|ref|NP_682821.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299574|ref|NP_682821.1|
Domain Number 1 Region: 4-129
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.15e-39
Family Transposase IS200-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299574|ref|NP_682821.1|
Sequence length 132
Comment transposase [Thermosynechococcus elongatus BP-1]
Sequence
MSSHLRKGRQSVTDLKIHLVCVTKYRRPVLSAEGLELIEKSFREVAMKMDFQILEFNGEE
DHVHALIEYPPKLSVSQIVNALKGVSSRRYGKAALPKPHEESLWSPSYFAASVGGALLEV
LKEYMRNQKKPS
Download sequence
Identical sequences Q8DHC8
gi|22299574|ref|NP_682821.1| NP_682821.1.97157 197221.tll2031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]