SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22299584|ref|NP_682831.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299584|ref|NP_682831.1|
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Hypothetical protein TM0160 1.44e-49
Family Hypothetical protein TM0160 0.0000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299584|ref|NP_682831.1|
Sequence length 173
Comment hypothetical protein tlr2041 [Thermosynechococcus elongatus BP-1]
Sequence
MAMIEMTVAGIALDATNRRTPIVLLKDGAGRRALPIWIGDHEARAILMALENQRAPRPMT
HDLMVNILNEWNMTLERVVIHSLEDNTYYAVLTLRQGETRKDIDARPSDAIALALRCHCP
IWVMEAVVADASIPVDRDADEEERQAFRRFLDSIRPEDFIQQARGMEEDSSAG
Download sequence
Identical sequences Q8DHB8
197221.tlr2041 gi|22299584|ref|NP_682831.1| NP_682831.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]