SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299599|ref|NP_682846.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299599|ref|NP_682846.1|
Domain Number 1 Region: 4-230
Classification Level Classification E-value
Superfamily PHP domain-like 1.1e-32
Family PHP domain 0.0084
Further Details:      
 
Domain Number 2 Region: 756-846
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.34e-17
Family Intein (protein splicing domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299599|ref|NP_682846.1|
Sequence length 872
Comment DNA polymerase III subunit alpha [Thermosynechococcus elongatus BP-1]
Sequence
MSFVGLHIHSDYSLLDGASQLPDLVARAMELGMPAIALTDHGVMYGAIELLKLCRGKPLK
PIIGNEMYVINGDITKQERKPRFHQVVLAKNKQGYHNLCKLTTISHLQGFQGKGIFARPC
INKELLAQYREGLIVTSACLGGEIPQAILQGKPELARSVAAWYQQTFGEDFYLEIQDHGS
QEDRVVNVELVRIGRELGIKIIATNDSHFISCHDVEAHDALLCIQTNKLLSDEKRLRYSG
TEYLKSAAEMARLFRDHLPDEVIQEALANTLEVADKIEAYNIFREPQSPEFPVPPGHTAD
TYLEQVAWQGLLERFQLSDRQQLEATYRQRLEYELKMLQQMGFSNYFLVVWDYIKYARDH
NIPVGPGRGSAAGSLVAYALRITNIDPVHHGLLFERFLNPERKSMPDIDTDFCIDRREEV
IQYVTQKYGSDRVAQIITFNRMTSKAVLKDVARVLDIPYSQADQMAKLIPVVRGKPVKLA
VMISEETPSPEFKEKYDSDPVVRRWIDMAMRIEGTNKTYGVHAAGVVIASEPLDQLVPLQ
RNNDGAVITQYFMEDLESLGLLKMDFLGLKNLTMLQKTQELIEKNHGQRIDLDALPLDDA
KTYQLLAEGKLEGIFQLESSGMHQIVRELKPSNLEDISSVLALYRPGPLDAGLIPKFINR
KHGREPIQYQHELLKPILSETYGVLCYQEQIMRMAQDLAGYSLGQADLLRRAMGKKKKEE
MEKHEALFIEGAAKNGVPSAIAQELFKQMLDFAEYCLSGETAVMTVEYGAVPIRRLVQER
LSCHVYSLDGQGHLYTQPIAQWHFQGFRPVYEYQLEDGSTICATPDHRFMTTRGQMLPIE
QIFQEGLELWQVAIAPRQALLQGLKPAVQMSG
Download sequence
Identical sequences Q8DHA3
NP_682846.1.97157 197221.tll2056 gi|22299599|ref|NP_682846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]