SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299672|ref|NP_682919.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299672|ref|NP_682919.1|
Domain Number 1 Region: 264-426
Classification Level Classification E-value
Superfamily CinA-like 3.27e-52
Family CinA-like 0.0000819
Further Details:      
 
Domain Number 2 Region: 14-216
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 9.95e-41
Family MoeA central domain-like 0.034
Further Details:      
 
Weak hits

Sequence:  gi|22299672|ref|NP_682919.1|
Domain Number - Region: 226-260
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0419
Family Phosphoglucomutase, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299672|ref|NP_682919.1|
Sequence length 430
Comment competence damage-inducible protein A [Thermosynechococcus elongatus BP-1]
Sequence
MSGNGCAAAKMTETMSAEIICVGTELLLGEILNSNAQFLAQQLASLGIPHYYQTVVGDNP
TRIKKVVAIACDRARLLIFTGGLGPTPDDLTTETLADFFATPLEERPEILADLERKYAHR
GGFSPSNRKQALLPVGAQILPNPLGTAPGMIWQPRTGLTILTFPGVPAEMKQMWHETAVP
FLCSQGWGKEVIYSRVLRFWGIPESMLAEKVAAQIAREHPTVAPYASNGEARLRITVRAK
DEAEAQQLIQPVEAEIRQIIGLDCYGADEDTLAGVVARLLQERQQTVAVAESCTGGGLGE
MLTRLPGSSLYFKGGVIAYANEIKVTLLGVNPEELEREGAVSAAVAAQMALGVKTRLASD
WGVSITGIAGPGGATLRKPVGLVYIGVALPNGEVISREFRFSGQRGRDWVRYLSTMNALD
LLRRQLLVNP
Download sequence
Identical sequences gi|22299672|ref|NP_682919.1| 197221.tlr2129 NP_682919.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]