SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299736|ref|NP_682983.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299736|ref|NP_682983.1|
Domain Number 1 Region: 301-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.14e-48
Family Ribonuclease PH domain 1-like 0.00000654
Further Details:      
 
Domain Number 2 Region: 7-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-42
Family Ribonuclease PH domain 1-like 0.0000396
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.11e-28
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 459-556
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.88e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 564-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.26e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 627-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.87e-17
Family Cold shock DNA-binding domain-like 0.00067
Further Details:      
 
Domain Number 7 Region: 237-328
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000392
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22299736|ref|NP_682983.1|
Sequence length 715
Comment polynucleotide phosphorylase [Thermosynechococcus elongatus BP-1]
Sequence
MKGLEKIIPLDGRDIKVVLQKFAPQAAGSILISSGETAVLVTANRAAAREGIDFLPLVVD
YEERLYAAGRIPGGFLRREGRPPEKAILIGRLIDRPLRPLFPQWLRDDLQVVATTVSLDE
NAPPDVLAVTGASIAVLLAQIPFNGPMAAVRVGLVGDEFVINPTYKEIERGGLDLVVAGS
PDGVVMVEAGANELPEADMIEAIDFAYEVIRDLIQAQRDLLKELGIDIVRAEPPAIDPTL
ENFIYDRAAEPVKAILKRFEKDKNVRDAALDEVQGAIAQEIAALPEDDPVAVAAAENPKA
LPTLFKAVTKKLMRQQIIEEGVRVDGRRLDEVRPIWCEVGVLPERVHGSALFNRGLTQVM
SVTTLGSPADAQALDDLHPEDSKRYLHHYNFPPYSVGEVKPLRSPGRREIGHGALAERAL
EPVLPPKEEFPYVIRVVSEVLSSDGSTSMGSVCGSTLSLMDAGVPIRKPVSGAAMGLIKE
GNEVRILTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKITGLPVAVIQQAIEQARPARL
HILEKMLAVLDKPRPQLPPSAPRLLTLQIPPDMIGLVIGPGGKTVRGISEQYNVKVDISE
EGLVTITAPNETNAKQARAAIEGLTRKLNAGDVYLGRVTRIIPIGAFVELLPGKEGMIHI
SQLAEYRVGKVEDEVKIGDEIVVKIREVDSKGRINLTRLGIHPDEAEAARSNSVV
Download sequence
Identical sequences Q8DGW9
NP_682983.1.97157 197221.tll2193 gi|22299736|ref|NP_682983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]