SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299779|ref|NP_683026.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299779|ref|NP_683026.1|
Domain Number 1 Region: 34-224
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000393
Family GAF domain 0.0079
Further Details:      
 
Domain Number 2 Region: 243-460
Classification Level Classification E-value
Superfamily PP2C-like 0.00000837
Family PP2C-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299779|ref|NP_683026.1|
Sequence length 463
Comment regulator of sigma-B activity [Thermosynechococcus elongatus BP-1]
Sequence
MSPALPSSSTTSSSPVIALKEMVSRLQRENSKIQELLASLSFALRSFNNLNQFFELIPLI
TCRVTEAEAAALVLFRADGQARLEQLHCHASDQCPNIRAALETATRTLANSVGMAAIDAG
SDRPQLEQLLDQQLRERLPQGIQFYATAILVKDSRLTERGRLYVFSQQPAYEWNETRQQL
LQVIADQTAVAIANDELALKLRDRQRLDRELEIGAEIQRRLLPHRCPKIHGLELAAECRT
ASWVGGDYYDFIPITYGLSDQQEIEQGRWGIAIGDVMGKGVPAGLIMTMTRGMLRAEALN
GHRPSRILQHLNRAMQPDLESSHRFVTLFYSEYNPQTRILAYSNAAHLPPLLWRAETGMI
HRLDTYGMLIGLDPRSQYQEAEVRLQPGDTVIYYTDGITEADNPKGKRFEEEGLAAVVKE
GCTKGLGAQALLDYIFDAVDTFTHTKGRRSDDMTLVILRVIDQ
Download sequence
Identical sequences Q8DGS7
197221.tlr2236 NP_683026.1.97157 gi|22299779|ref|NP_683026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]