SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299783|ref|NP_683030.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299783|ref|NP_683030.1|
Domain Number 1 Region: 312-611
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.22e-89
Family DNA repair protein MutS, domain III 0.00000173
Further Details:      
 
Domain Number 2 Region: 613-845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.73e-60
Family ABC transporter ATPase domain-like 0.00000116
Further Details:      
 
Domain Number 3 Region: 145-311
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.27e-42
Family DNA repair protein MutS, domain II 0.00028
Further Details:      
 
Domain Number 4 Region: 35-146
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.57e-37
Family DNA repair protein MutS, domain I 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299783|ref|NP_683030.1|
Sequence length 874
Comment DNA mismatch repair protein MutS [Thermosynechococcus elongatus BP-1]
Sequence
MSNDRPLTHSEAESSALRLGRNPGLQVRHDEVERSLLTPMLQHYAELKDAYPHALLLYRV
GDFYETFFQDACTVARELELVLTGKEGGKEVGRVAMAGIPHHALERYCRTLIEKGYAIAI
CDQVEDPAQAQGLVKREVTQVFTPGTVLDTELLQPRRNNFLAAVVLSGNHWGLAYADVST
GEFCTTQGSDRADLVAELNRLQPAEILLPTEAPDINRVLRPGEGKDQLPPELPPQWCYTL
RSPEDFQAAAARQRLCQRFQVKSLEGFGCEHLPLALRAAGGLVAYLDETHRQQPVPLQNL
STYSLQQYLFLDPQTRRNLELTQTVRDGSFQGSLLWAIDRTATAMGGRLLRRWLLQPLLD
IEEITARQDAIAELMANSSLRQSLHRHLQEIYDLERLAGRAGSGTANARDLAALRDSFRT
LVSLAAVVANTSSPYLQALAQLPPVIEQLADTLSAALVDQPPTSLSEGGILRPGAYPELD
QQRQQIEQDQQWILNLEAQERQRTGISTLKVGYTKVFGYYLSVSRAKLNQVPDDYIRKQT
LTNEERFITAELKEREARLLAAQSHLFELEYQYFVQLREQVAAQASTIREIAAAVAAVDA
LLGLAEVALYQGYCRPQLTRDRQLCIRGGRHPVVEQTLPAGFFVPNDTQLGTGADLMVLT
GPNASGKSCYLRQVGLIQLLAQMGSYVPATSATLGICDRIFTRVGAVDDLATGQSTFMVE
MNETANILNHAGDRSLVLLDEIGRGTATFDGLAIAWSVAEYLATILKSRTIFATHYHELN
QLATLLPNVANYQVVVKELPNEIIFLHQVKPGGADRSYGIEAGRLAGLPAVVIQRAREVM
CQIEKHSRITVGLRKSSMGDPPTAPEINQGELPF
Download sequence
Identical sequences Q8DGS4
NP_683030.1.97157 197221.tlr2240 TeR252 gi|22299783|ref|NP_683030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]