SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299786|ref|NP_683033.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299786|ref|NP_683033.1|
Domain Number 1 Region: 7-238
Classification Level Classification E-value
Superfamily PP2C-like 1.17e-79
Family SCOPe 0.0000000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299786|ref|NP_683033.1|
Sequence length 240
Comment protein serin-threonin phosphatase [Thermosynechococcus elongatus BP-1]
Sequence
MDVAGLTDCGLIRKSNQDAFYIDEKHQRFFIVADGMGGHAGGEEASRLAVDHIRQYLETH
LEDLQHDPVTLLRQAFLAANHAIVEQQRQNSARADMGTTAVVILLDEKGDRAWCAHVGDS
RIYRWRKDQLQQITSDHTWIAQAVQLGSLTIEQARQHPWRHVLSQCLGREDLSQIDIQPI
DLEPGDRLLLCSDGLTEELTDDVISIYLSEPNVQKAAAALVDAAKTHGGRDNVTVVVISV
Download sequence
Identical sequences Q8DGS1
2j82_A 2j86_A 2j86_B NP_683033.1.97157 000166161|e2j82A1|210.2.1.2|A:1-240 000330755|e2j86A1|210.2.1.2|A:1-240 000330756|e2j86B1|210.2.1.2|B:1-240 001827848|e5itiA1|210.2.1.2|A:4-243 cath|current|2j82A00/1001-1240 cath|current|2j86A00/1-240 cath|current|2j86B00/1-240 d2j82a_ d2j86a_ d2j86b_ d5itia_ gi|22299786|ref|NP_683033.1| 197221.tlr2243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]