SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299875|ref|NP_683122.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299875|ref|NP_683122.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-107
Family BC ATP-binding domain-like 0.000000011
Further Details:      
 
Domain Number 2 Region: 697-958
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-104
Family BC ATP-binding domain-like 0.000000203
Further Details:      
 
Domain Number 3 Region: 396-551
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 4.05e-55
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000902
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.05e-49
Family BC N-terminal domain-like 0.00000238
Further Details:      
 
Domain Number 5 Region: 574-699
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.38e-46
Family BC N-terminal domain-like 0.00000309
Further Details:      
 
Domain Number 6 Region: 961-1097
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.62e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299875|ref|NP_683122.1|
Sequence length 1100
Comment carbamoyl phosphate synthase large subunit [Thermosynechococcus elongatus BP-1]
Sequence
MPRRTDISRILIIGSGPIVIGQACEFDYSGTQACKALREEGYEVILINSNPATIMTDPEI
ADRTYIEPLTPEMVEKVIAAERPDALLPTMGGQTALNLAVALAKSGVLDRYGVELIGAKL
PAIEMAEDRKLFKEAMQRIGVAVCPSGLANTLEEARAIAQEIGVYPLIIRPAFTLGGTGG
GIAYNQEEFEAIATAGLEASPVSQILIEQSLIGWKEYELEVMRDMADNVVIICSIENIDP
MGIHTGDSITVAPAQTLTDKEYQRLRDAAIKIIREIGVETGGSNIQFAVNPETGEVIVIE
MNPRVSRSSALASKATGFPIAKIAAKLAVGYTLPEIPNDITQKTPASFEPTIDYVVTKIP
RFAFEKFPGSPPVLTTQMKSVGEAMAIGRTFQESLQKALRSLETGRAGWGCDRPEKLPSL
EQLRGKLRTPNPERIFAIRHAFLLGMTVEEIYELTAIDPWFLRQMQGLLETEKFLKRSKL
EQLTADDLWRIKQQGFSDAQIAYATKTTDDQVRAYRQSLGVVPVYKTVDTCAAEFEAYTP
YYYSTYERPLEQINPDSGDVELLPPESEVLPPRKPRVMILGSGPNRIGQGIEFDYCCCHA
AYALRADDYETIMVNSNPETVSTDYDTSDRLYFEPLTKEDVLNIIEVERPVGIIIQFGGQ
TPLKLALPLQRYLQQQGDRLGTQIWGTSPDSIDIAEDRERFEKILRELNIPQPPNGTARS
YAEALSIAERIGYPVVVRPSYVLGGRAMEIVYSNGELERYMNAAVQVEPGRPILIDKYLE
NAIEVDVDAIADATGTVVIGGIMEHIEQAGIHSGDSACSLPTQSLSPAVLQTIRTWSIAL
AQALKVVGLMNLQLAVQGDQVYILEANPRASRTVPFVSKAIGIPLAKVAARLMSGKTLAE
LNFLNEKIPNHVAVKEAVLPFEKFAGTDTVLGPEMRSTGEAMGIDMTFGAAYAKSQLAAN
QRLPLKGTVFVSMSDRDKAAIVPVVQELQSLGFRMIATEGTRNALLEAGLSNIELILKLH
EGRPHVLDAIKNGQIHLILNTPSGQEARTDAQLIRRTALAYKIPIVTTIAGAKATAAAIK
TLQTSTLGVRALQDYHRVEC
Download sequence
Identical sequences Q8DGI5
gi|22299875|ref|NP_683122.1| 197221.tll2332 NP_683122.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]