SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299938|ref|NP_683185.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299938|ref|NP_683185.1|
Domain Number 1 Region: 8-248
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 1.96e-60
Family YjeF N-terminal domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 225-495
Classification Level Classification E-value
Superfamily Ribokinase-like 1.17e-56
Family YjeF C-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22299938|ref|NP_683185.1|
Sequence length 505
Comment hypothetical protein tll2395 [Thermosynechococcus elongatus BP-1]
Sequence
MKPTFPAIVTTAEMQAIEGAMFNGGLPIPALMEKVGQRLSHYLQAHFPTSQYPRVAVLAG
PGHNGGDALVVARELWHRGYQVKLWQPFERLKPLTADHARYARFLGLPFVERVEALQEVD
VIVDGLFGFGLERELTGELAHAIDEINTWPQPRVSIDVPSGLHSDTGAVLGTAIRADRTL
CLGLWKRGLLVEEAQPWVGQGVLIPFDIPSVVIETALASAPRRYCLDDSCWQALPLSRSP
ITHKYQQGQLLLIGGSGQFGGSILLSALAARCTGVGMLVVAVPQSLKSLVLSRVPDAIVV
GCPETPRGAIARLPEGLELGKFSAIACGPGLTPEAVSVVATVLRAETSLVLDADALNILA
TLSPWPLPSGTILTPHYGEFRRLFPDLVGTAGDRLDQVIAAARWSNAIVLLKGARTAIAS
ARGDLWINPHSTPALARGGSGDVLTGLIGGLLAQQEALRATYGGVWWHAQAALEAEQQAT
SLGVYPEQLIAHLLPTLRRALAARV
Download sequence
Identical sequences Q8DGC3
NP_683185.1.97157 gi|22299938|ref|NP_683185.1| 197221.tll2395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]