SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299961|ref|NP_683208.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299961|ref|NP_683208.1|
Domain Number 1 Region: 20-241
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.27e-57
Family Class I glutamine amidotransferases (GAT) 0.00000834
Further Details:      
 
Domain Number 2 Region: 201-429
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.51e-56
Family N-type ATP pyrophosphatases 0.00000178
Further Details:      
 
Domain Number 3 Region: 415-535
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.7e-54
Family GMP synthetase C-terminal dimerisation domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299961|ref|NP_683208.1|
Sequence length 535
Comment GMP synthase [Thermosynechococcus elongatus BP-1]
Sequence
MTHSTLHQPDTATGQGLQRQLIVILDFGSQYSELIARRIRETQVYSEVISYRTTAEQLAQ
LAPKGIILSGGPNSVYDENAPQCDPEIWNLGIPILGVCYGMQLMVQQLGGTVERAIAGEY
GKAALFIDDPTDLLTNVEQETIMWMSHGDSVTELPPGFRVLAHTDNTPIAAIAHPERKLY
GVQFHPEVVHSVGGIALIRNFVYHICDCEPTWTTAAFVEEAIREVRAKVGDKRVLLALSG
GVDSSTLAFLLHRAIGDQLTCMFIDQGFMRKGEPERLLKLFQEQFHIKVEYVNARDRFLA
QLVGVTDPEEKRKRIGHEFIRVFEEESQRLGPFDYLAQGTLYPDVIESANTNIDPQTGER
VAVKIKSHHNVGGLPENLRFKLVEPLRKLFKDEVRQVGRSLGLPEEIVQRHPFPGPGLAI
RILGEVTPERLEILRDADLIVRQEINRAQMYHELWQAFAVLLPIRTVGVMGDQRTYAYPV
VLRFVTSEDGMTADWARVPYDLLERISNRIVNEVPGVNRVVYDITSKPPGTIEWE
Download sequence
Identical sequences Q8DGA5
197221.tll2418 NP_683208.1.97157 gi|22299961|ref|NP_683208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]