SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22299603|ref|NP_682850.1| from Thermosynechococcus elongatus BP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22299603|ref|NP_682850.1|
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 3.02e-19
Family Ribosomal protein L33p 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22299603|ref|NP_682850.1|
Sequence length 64
Comment 50S ribosomal protein L33 [Thermosynechococcus elongatus BP-1]
Sequence
MAKAKGARIIITLECTECRTNPAQRSPGVSRYTTTKNRRTTTGRLELKKFCRYCNKHTIH
REIK
Download sequence
Identical sequences Q8DH99
NP_682850.1.97157 197221.tsr2060 gi|22299603|ref|NP_682850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]