SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501676147|ref|YP_007996474.1| from Candidatus Phytoplasma australiense Strawberry lethal yellows phytoplasma (CPA) str. NZSb11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501676147|ref|YP_007996474.1|
Domain Number 1 Region: 11-200
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.28e-45
Family PP-loop ATPase 0.00029
Further Details:      
 
Domain Number 2 Region: 347-416
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000034
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|501676147|ref|YP_007996474.1|
Sequence length 435
Comment tRNA(Ile)-lysidine synthase [Strawberry lethal yellows phytoplasma (CPA) str. NZSb11]
Sequence
MKLALKLDFQKTYIIAVSGGVDSMVLLDFLWSQKYKLKVVHFNHLKRLNAIKDKNLIQSY
CDQRKIPFYYFELQLNPQNFQTEARLLRQEKLKQIAKKYQTPYVITAHHLDDLAETILQK
ISRGSTLLGYSGMQPKLFFEEFIFLKPFLYLAKAEIIAYAQKNKIAYLSDYTNQLDIYQR
NQIRNHVIPYLKEKTNFLQNIKKFSCLLSETQDFIRKQTLFFIQHNKAPKESFFSFQKDT
NFFLIKSFLFLDKVIQKDIIIYLLEQKRIDKNWLVVESIIKGLAFAKNPNLSWKLNSNYD
LIKSYNYFGIIALDGFLKFKKKFFKKPLLYASTCKVCLASLQQVITLNCDLVNIAFPLKL
RQRKPGDYLKFSFGKQKLKNFLINKKVPLFERDNLWLIVDSKDNVLWIPHLYINHTLGNK
DLFSLGLKKETFNYL
Download sequence
Identical sequences B1VA48 R4RLI2
gi|197294532|ref|YP_001799073.1| 59748.PAa_0487 gi|501676147|ref|YP_007996474.1| WP_012358960.1.17149 WP_012358960.1.56962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]